CoIP, ChIP, CUT&RUN, CUT&Tag Expert! My Basket (...)
Worldwide delivery!
Having the Best Alpaca Nanobody Products!
Home | About us | Contact us | How to order |
    My Base Info
    Shopping Basket
    My Orders
    My Shipping Info
    Modify Password
    Log Out

    Anti-AMPK beta 2 Rabbit mAb

    Catalog number :AT0613
    loading...
    AMP-activated protein kinase (AMPK) is highly conserved from yeast to plants and animals and plays a key role in the regulation of energy homeostasis. AMPK is a heterotrimeric complex composed of a catalytic α subunit and regulatory β and γ subunits, each of which is encoded by two or three distinct genes (α1, 2; β1, 2; γ1, 2, 3). The kinase is activated by an elevated AMP/ATP ratio due to cellular and environmental stress, such as heat shock, hypoxia, and ischemia. The tumor suppressor LKB1, in association with accessory proteins STRAD and MO25, phosphorylates AMPKα at Thr172 in the activation loop, and this phosphorylation is required for AMPK activation. AMPKα is also phosphorylated at Thr258 and Ser485 (for α1; Ser491 for α2). The upstream kinase and the biological significance of these phosphorylation events have yet to be elucidated. The β1 subunit is post-translationally modified by myristoylation and multi-site phosphorylation including Ser24/25, Ser96, Ser101, Ser108, and Ser182. Phosphorylation at Ser108 of the β1 subunit seems to be required for the activation of AMPK enzyme, while phosphorylation at Ser24/25 and Ser182 affects AMPK localization. Several mutations in AMPKγ subunits have been identified, most of which are located in the putative AMP/ATP binding sites (CBS or Bateman domains). Mutations at these sites lead to reduction of AMPK activity and cause glycogen accumulation in heart or skeletal muscle. Accumulating evidence indicates that AMPK not only regulates the metabolism of fatty acids and glycogen, but also modulates protein synthesis and cell growth through EF2 and TSC2/mTOR pathways, as well as blood flow via eNOS/nNOS.
    Overview
    Reactivity
    Mouse, Rat, Human, Monkey
    Tested applications
    Western Blotting 1:1000 
    Immunoprecipitation 1:50
     
    Specificity
    AMPKβ 2 Antibody detects endogenous levels of total AMPKβ 2 protein. The antibody does not cross-react with AMPKβ 1.
    Properties
    Immunogen
    Recombinant full length protein corresponding to Human AMPK beta 2 aa 1-272.
    Sequence:
     
    MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPD SKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWS TKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTIN NLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEE RFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSV MVLSATHRYKKKYVTTLLYKPI
    Database link: O43741
     
    Clonality
    Monoclonal, clone number: 23A7
    Isotype
    Rabbit IgG
    Form
    Liquid, 100 μl,1mg/ml
    Storage instruction
    Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C 
    Applications
    WB Image

    Anti-AMPK beta 2 antibody at 1/1000 dilution + Human lung carcinoma cell line lysate
    Predicted band size: 30 kDa
     

    Related Products

    Reviews

    loading...
    Content *:
    Customer Review :
    Verification Code * :
    refresh image

    Shipping and Paying Info
    ......
    Order Information
    You can place an order online step by step as blow.

    Step 1. Register for a new account and Log in, Find out your product by searching our website.
    Step 2. Add the Product into your shopping basket, select your settlement currency.
    Step 3. Checkout by Paypal, Pay by credit card or bank transfer for your order.
    Step 4. Ship the goods for you, providing you package tracking numbers. 

    Any questions, please contact us via email: sale@engibodybio.com
    Payments by
    All our products are For Research Use Only. Not for diagnostic or therapeutic usages.