CleaTag™ HRV 3C Protease (His-tagged)
Catalog number :P5541
HRV 3C Protease is highly specific for the recognition sequence Leu-Glu-Val-Leu-Phe-Gln-↓-Gly-Pro and cleaves after the glutamine residue. The recombinant enzyme is engineered as a fusion protein with polyhistidine (6xHis) tags, so that the protease can be easily removed after cleavage using a variety of solid supports with immobilized metal chelates, respectively. HRV3C is also active in a variety of commonly used buffers, providing further flexibility in experimental design.
- Overview
- Description
- CleaTag™ Recombinant HRV 3C Protease (His-tagged)
- Properties
Synonyms HRV 3C protease, 3C protease Origin of species human rhinovirus (HRV) 3C protease Source expressed in HEK293 Unit Definition One unit is defined as the amount of enzyme needed to cleave 100 μg of fusion protein in 16 hours to 90% completion at 5°C in a buffer containing 50 mM Tris-HCl, pH 7.0, 150 mM NaCl, 1 mM EDTA, and 1 mM DTT. Cleavage Buffer 50 mM Tris-HCl, pH 7.0 (at 25 °C), 150 mM NaCl, 1 mM EDTA, 1 mM dithiothreitol. Chill to 5 °C prior to use. Appearance Clear aqueous solution, filter-sterilized Molecular Weight ~22kDa
- Database links
- UniProt: P03303 (POLG_HRV14)Protease 3C activity domain>sp|P03303|1538-1719GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
Related Products
Reviews
loading...
Payments by 
All our products are For Research Use Only. Not for diagnostic or therapeutic usages.