Anti-STAT3(phospho Y705) Rabbit mAb - ChIP, CUT&RUN and CUT&Tag Grade

Product

Anti-STAT3(phospho Y705) Rabbit mAb - ChIP, CUT&RUN and CUT&Tag Grade

Catalog number :AT0604

The Stat3 transcription factor is an important signaling molecule for many cytokines and growth factor receptors and is required for murine fetal development. Research studies have shown that Stat3 is constitutively activated in a number of human tumors and possesses oncogenic potential and anti-apoptotic activities. Stat3 is activated by phosphorylation at Tyr705, which induces dimerization, nuclear translocation, and DNA binding. Transcriptional activation seems to be regulated by phosphorylation at Ser727 through the MAPK or mTOR pathways. Stat3 isoform expression appears to reflect biological function as the relative expression levels of Stat3α (86 kDa) and Stat3β (79 kDa) depend on cell type, ligand exposure, or cell maturation stage. It is notable that Stat3β lacks the serine phosphorylation site within the carboxy-terminal transcriptional activation domain.

Overview

Reactivity: Mouse, Rat, Human

Tested applications: WB : 1/500-1/2000. Predicted molecular weight: 86kDa.

IHC : 1/100~1/500

IF/ICC : 1/100~1/250

IP : 1/100

ChIP, CUT&RUN and CUT&Tag. Optimal dilutions/concentrations should be determined by the end user.

Specificity: Phospho-Stat3 (Tyr705) Rabbit pAb detects endogenous levels of Stat3 only when phosphorylated at Tyr705. This antibody does not cross-react with phospho-EGFR or the corresponding phospho-tyrosines of other Stat proteins.

Properties

Immunogen: Synthetic peptide within Human STAT3 aa 685-725 (phospho Y705) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.

Sequence:KYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLP

Database link: P40763

Clonality: Monoclonal, clone number: 3GF7

Isotype: Rabbit IgG

Storage instruction: Store at -20°C

Applications

WB Figure 1: Western blot

expression in (1) HeLa cell lysate; (2) HeLa cell lysate treated with IFN-a.

Observed band size: 86kDa

Recommended secondary antibody: Goat anti rabbit IgG-HRP (Engibody, Catalog number:AT0097)

Recommended ECL: ECL Pico-Detect™ Western Chemiluminescent HRP Substrate (Engibody, Catalog number: IF6747)

WB Figure 2: Triptolide delays disease progression in an adult rat model of polycystic kidney disease through the JAK2/STAT3 pathway. -American Journal of Physiology-Renal Physiology

Observed band size: 86 kDa

Recommended secondary antibody: Goat anti rabbit IgG-HRP (Engibody, Catalog number:AT0097)

Recommended ECL: ECL Pico-Detect™ Western Chemiluminescent HRP Substrate (Engibody, Catalog number: IF6747)

IHC Image: Immunohistochemical analysis of paraffin-embedded human pancreas, using Phospho-STAT3 (Y705) Antibody.

ICC/IF Image: Immunofluorescence: HeLa cells treated with IFN-alpha, using Phospho-STAT3 (Y705) Antibody. The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.

Anti-STAT3(phospho Y705) Rabbit mAb - ChIP, CUT&RUN and CUT&Tag Grade

Related Products

Reviews